SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85925
Domain Number 1 Region: 446-510
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000334
Family Retroviral integrase, catalytic domain 0.046
Further Details:      
 
Domain Number 2 Region: 212-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000157
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85925
Sequence length 524
Comment (Phytophthora ramorum)
Sequence
MTTKRAEVLLGSGNYFHWEYNMRMTLARKGLLAHVQKVKAESEITEAWLVNDAKALGIIA
QGVELQHQTKIRSATRAIQAWGTLREFYNRTTLHNRVTMTRRLHDFKMDDGTSMAKHLDD
FDELVVGLQTMGEPVDEARQLVVLLSSLPAEYEMITSIIENAKDITLIEVKEKLLKEHER
LEKKDLATERAFKVNAGRFKGGKGDGRKWNVSKRNTGEFRGKCFKCNQPGHMKRDCPVRN
TGGDDDAVFAVGTERFNGWLIDSGATAHMTPHRSDLVEYEALDAGMEVTIADGKKLAVAG
RGTVRLLGLDQKTIKMVDVLHIPGLDRRLLSVGKLAERGLNVEFQRSSCVIWGNTSAIAL
GKKVGKTYVLDCNQEEARFVQYAGADSQWELWHARLGHPNKDAMVKTQRATNGIPAVEQA
FKTLCGGCMKGKQTVASFPKCSGTKTSRVLELVHTDVMGPMKTPSKGSAKYILTFVDDYS
RYVVAYFLKKKSEVAAKIKEFTRFYEKQWGNASCAFDQTMERSS
Download sequence
Identical sequences H3H5K9
164328.JGI85925 jgi|Phyra1_1|85925|fgenesh1_pg.C_scaffold_373000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]