SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85934
Domain Number 1 Region: 641-917
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.56e-44
Family Reverse transcriptase 0.0033
Further Details:      
 
Domain Number 2 Region: 1000-1158
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.44e-33
Family Retroviral integrase, catalytic domain 0.0084
Further Details:      
 
Domain Number 3 Region: 1312-1371
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000733
Family Chromo domain 0.012
Further Details:      
 
Weak hits

Sequence:  164328.JGI85934
Domain Number - Region: 343-378
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000607
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85934
Sequence length 1402
Comment (Phytophthora ramorum)
Sequence
MESEEAADLSIDVPPLPASPEPQEMHAATPTSNRAARGLGGQRRLLWSGPFATLTAGSAA
WGSSSDDGDVTMATASPGRDTPAARASSAEKEKAESGRITNAPTLPAAPRYAGSTMKDRR
SFMRAYETYYHALSAFDTGFARPFIMPVSGCIEERTCQMICMYEFQKNPNEVSEGEWISY
FLQAREPELEDYTAVDLAMKQLKMKTTFPDAASRMGQLRADMHHILDEHTVEQVMLEREQ
KKVVKYFVAALEPAEFREAIQKRLQYAQHKALKTDIVKCYAWVLEQLKAYLVWQPAQVKP
QARPQSKFGQQPRRPQQEDNHSHGAKPGPSSGNSSRGRAGPTEGKPPPKPRSGNPPRRTC
LKCGSQTHLVRQCPDVTPDEVDKLLAARNPSTNSATSTHFKRVQVVNEDSAETGCAQATT
SNHPLRHSIGLRDDDGTAQTTIDGFTLQTSLLDSGADDSVVSGGIVRALESAGVPILTFS
ANTALEPVGGHLIPVARKVRFGEVEFATSAGPLLLRNLDCLVHEEDRSLALTVGRPVMNR
LGYSTDDLLAAARTRQPEYCLTEPAEEDSDKNNSPLVRVQAMRTRLLDELDVDGDDLDEL
VASPRLVAETTRAVQEALELKIQEARANGLTSKEGDDLQELLFRHIDVFRLSFGDDPPVR
VPPLRVHLKEGARPVKAKARRYPPDHKRYLEEHIEELVRHGLVKKNHRSRWASAPRIVAK
RKPGEYRMTVDTRAVNALTEPMPWPMPDIEADLAQVEDSEAYFTIDWWRGYWQLPLDEDS
QELYTIMTHRGMFTPTRVLMGSTDAVAYCQGVVEEIFGPLRGGQILAWLDDILGYARSPS
ALLVVLKNVLELCAEYAKLYEVLEAAATVAQSRKKTRLHRVLLDSVGWGPEHDTALANVK
DALLKMVTLAHPKDDWELAARDPSDALPLCRWNDEMGLFVTESGRIWIPEHGHRGEGVTQ
QMLAEKFDWPTLKADVKAFVRSCLHCMVVGERVVPRPFGQALHASAPNEVLHFDFLSLPA
SSTGEPYVLVLKDDMSGYCELVTCESATAEAACSALLDWFKRFGPVTQWISDRGTHFKNT
ILEQVRKFYGGSHHFTTAYCPWSNGTVEVVNRLLLRCMRAMLSELKLHAAEWPTILPLVQ
SALNQMPADRLGGVAPVTAFTALPASPPIHAILHPQTQVLFDVEAVYEKQRQHLADIRVA
LDNMHRAVTSVAETKREQARARRAAQSGVHMANFEIGDFVLVAQVIGRVNKLAVHWRGPR
RIVRALTDYIFEVQDLSPPFQVSTHHASRLQLYADSRRDVTEDLIAHAMHADGGHLVAKF
LKCRLGAESHVWEIEVEWVGLDPLEASWEPAAIMFEDVPRLVEQFVNSQPDDSAAHAMWS
SLVDERPRTPTKKGKGASKKRG
Download sequence
Identical sequences H3H5L7
jgi|Phyra1_1|85934|fgenesh1_pg.C_scaffold_378000002 164328.JGI85934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]