SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86000
Domain Number 1 Region: 219-361
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.92e-22
Family Retroviral integrase, catalytic domain 0.009
Further Details:      
 
Domain Number 2 Region: 546-692,726-863
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000116
Family Reverse transcriptase 0.023
Further Details:      
 
Weak hits

Sequence:  164328.JGI86000
Domain Number - Region: 16-49
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000134
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86000
Sequence length 923
Comment (Phytophthora ramorum)
Sequence
RVADANAATVERKKRSKTSNSKSSITCWDCGGAGHTAAFCPRQPDGRERQQAARRQSRGW
RTVVARRRGKLKIEALVDDGAGACITRAFELENVYFVPNFAKTLLSVSTLIHAGHEVVFT
PAGCTVYQPKRRGRVACIARDGNGVYPLLTKDQAHVDDAIQVALAISVLGTDLATWHRRF
GHVNYKTLKEMAKNKVVKGLRIAKGAKPPMCVVCAITKAVDRAPPKVYPLKRKNEAASKV
SAFLKMIERQAAIPVSEVKVVRTDGGTEFINKDFRRVLQREGIVQEHTARYSSSQNGVAE
RAIRTLTEMAAAMLTDSGLLHSMWADALKHAAFLRNRIPKRGQTIRPHEKLFKRKPDISK
VPVFGQAVSVRVPEEIRIKYQRFKKDSCEELGAFVGCTDEVKGFNILLPGPGQPVFEARG
ATVINRMLHEIEPVGEDNEAGFEYDARRSPRWEEWHRAIVKEVQALFDNGTFEWVDAPDG
ATVLDHTIQFRLKTGALGELVQFKARLCARGDHQHFLVDYVATYAPVAPLTTVRVFFVLV
AKLGLVVRQGNVPAAYVKADLQEVIYMKPVAGYSGSTNVGKVWRLRKALYGLKQAGSEWN
KAIDEYFRSQGLQPTEVDPCLYFAYTHGSLLLVCLYVDDLLVAHASETKVSRMMAALLQQ
YGVKDLGAPNSFLGVHIERDKSGTVLLSQSAYIDEVLHGFAMDGARQQRTPMVPNTRLDE
LNDDPSPSESALIRRMPYREAVGALLYLARVTRPDISFTVGQLARHCARPRKVAWDAAKF
LMRYLGSTRNKKLRLAPTGDDILVTSDADWANDKTDRKSISGRVVFLFGCPVTWCSKKQT
IVAKLSTAAEYMSADYAVEDGEQVRLMVEQVLKRDVPMTLAMDSQPAIARLQREGLSETQ
KTVDVWYKRVKGMLKDGKIAVEQ
Download sequence
Identical sequences H3H5S1
jgi|Phyra1_1|86000|fgenesh1_pg.C_scaffold_412000003 164328.JGI86000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]