SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86137 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86137
Domain Number 1 Region: 476-607
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.36e-23
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000565
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86137
Sequence length 609
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSMWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRLQD
VVKVLTNERIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCLTKQKDENR
GPRRGGNGNGRERGANNAQWRNDDASYDYGCGYDRVAFAVSLMRGISTGKDMLGMWVVDS
GATHHICNDKAKFAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKEAL
YVPSMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSA
NAATSGKTVDLHVRMGHAPMEVLRKMVDNNVIQDAKAPSKSSGPSVCRGSAPCGPMEEES
LGGSNYLLLIADEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFGKKVKFVRHDGAREFA
TNSLKAFYEVEGIEQQTTVPYAHQTNGTAERAIRTIVTIDRSMLHHAKLDKCFWAEAAMT
AIYVKNRLL
Download sequence
Identical sequences H3H646
jgi|Phyra1_1|86137|fgenesh1_pg.C_scaffold_483000001 164328.JGI86137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]