SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86138 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI86138
Domain Number - Region: 633-674
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00314
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86138
Sequence length 721
Comment (Phytophthora ramorum)
Sequence
MVRVPGSSGDSQGFHRESTEEDVKIKMEPGNESSTEEGSPPTALKAPGSTDRESAGRSSD
DVKEEGSAMDLEEKPQTPPQVPSGTPADRDANRDPPDEGPTVKTEGPSSKTTPPVPHATS
KKKKSKPSRKKLKAPESEAEDQEDCNTWMDEQLESAFFYKDLYKFLHEDPVMKIVRPKPI
GELQGPVKAPKEVTSQLEAVKLLMRMLKEAEIVLGSFDANELFDLELPIIRESTLSLFAK
LTPLVGSVVPVQRERPAPTRSQTGSSQYASDTSEAGSDSSIELQRMTLGPAGAAMLQSRK
ERSETKPRVIATSDPAQAPPERMQSFFNAAMERFLKEQQAVSTTPVVDQTKPPGAQDVDM
ESVESNRRDHSHPSEYDPDDLGVDATPRAAVASAGTTGGGTLSATRIRVSAISELKEFSG
KDNDEDRARSWFGKLKSAFVRDQAPDGEKCLVFGDLLTGPARNWYRQLSRTTRGNWKSLS
KNFQTQYCGRGVSVARQYYHARKRSDESPLEYLHRLNVAGLRAQLSIKDESIEVRREHVD
HFIETLDDRDLASQLALLRIPDADTLEETLRSRQLNSSDSELETSGSEGEGDLRKVYFAA
TPDQPTRSHSDQEQRRPSRDSNDRRLDRPAGSLEGEAPRKPCSHCGSSKHTDLGCWKRLT
CEKCGKKGHPTDRCLFVCKACGEIHGAGECPMEEFYNLIRQWYNPTKHGGMLPQAAEKML
N
Download sequence
Identical sequences H3H647
164328.JGI86138 jgi|Phyra1_1|86138|fgenesh1_pg.C_scaffold_484000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]