SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86147 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86147
Domain Number 1 Region: 639-940
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.05e-69
Family Reverse transcriptase 0.00031
Further Details:      
 
Weak hits

Sequence:  164328.JGI86147
Domain Number - Region: 419-480
Classification Level Classification E-value
Superfamily Acid proteases 0.00289
Family Retroviral protease (retropepsin) 0.0096
Further Details:      
 
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00586
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86147
Sequence length 956
Comment (Phytophthora ramorum)
Sequence
MGDKDDVNVDELTARAAELQLESAASRSPRSPGLRLRIPNPFEREDEVMETASQASPMGH
AGTSRVAAAPTLPQPPRFEGRSMQDRRDFMHKYETYLGAINALQTQWSGAFAMPVGACIE
SKTKRMIARYEFNQLPGAITEEQWVAYFLQAKTPSHVDYTSVDEAMKALRMQTRWPEPES
RMMNLQSDMEAILDRFNLTDLAFQHEQRRLVKYLAAALAPPGFKAVINTKLTLQENRTYK
HEVVPFCSWVTQLMKEFMTWEHAAQVSGGQPGPSAQNQPRSGSGGRGGNGGRGANTGRGA
GGGDNTPTRGAQGSPSIRGGRGDQHGRGGRGYGSTRPQESTRPQESPSRGPTPETRSGRG
ACLKCGSSEHQVRQCPLCSSEEAVELLRGRREQHAGTRGVSMNKFDVVTASDSVLTAGED
RGTVEAAVEGVPVKALLLDSGADTSLVARGVLDSIGQAGKPVAVRTIHPVRLSPVGGREV
VVQRMATFSEIVLTTSAGPLLLRNLACFVEEDNSRMELTVGRPIMKILGYSTDKLLVEAR
DAQAEWELGGDTSPKVDKDQSSPTSLQRIYRLAVAAQDPGPDAEEEDIYRHETRTALPCM
QPTNLAEVTHYLESKVEIATRMGLTLDGSAKLRGILQMRADSFRLEFGHDPPVRVAPMQV
RLKPGATPIRAQPRRYSPNDRAFLDRHTTTLMKHGLIFKNHRSRWASAPRIVKKKEQADD
PLADPRMTIDTRSVNERTEPMPWPMPVLEVVIGELEGAKVFFVLDWFRGYWQLPLHPDSQ
EIYSFVTHRGIYTPTRVPMGATDAVAYCQGVVEEIFGDLLGTCILAWLDDILGYAEDEAS
LLEVLDKVLERCEKFGLKLHAKKCQFFATEVKWCGRMTSAQGVRHCPERIQGLVEMQAPQ
TAGDLQQFLCAVNWMRQSIPEFTRITAVLYDALDRAAQIAGSRKKQRLLGRRRHDA
Download sequence
Identical sequences H3H656
jgi|Phyra1_1|86147|fgenesh1_pg.C_scaffold_491000002 164328.JGI86147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]