SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86207
Domain Number 1 Region: 343-498
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-24
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 2 Region: 683-886,914-1100
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-16
Family Reverse transcriptase 0.059
Further Details:      
 
Weak hits

Sequence:  164328.JGI86207
Domain Number - Region: 66-89
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000293
Family Retrovirus zinc finger-like domains 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86207
Sequence length 1149
Comment (Phytophthora ramorum)
Sequence
MEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATMKTED
AAKAFNTDRESRQCTYCGKLGHTIDKCWTKQMDENRGPRRGGNGNGRGRGANNAQWRNDD
ASYNYGYGYDRVAFAISLECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERNEGEL
SVADGNKAATMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINKSGLFQVV
FDGIQIRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSEKTVDLHARMGHAPVEVLR
KMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTFELLHFDICGPME
EESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTNVTKVQTQFGKKVKLCGTTELA
FYEVEGIEQQTTVPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTAIYVKN
RLPSPKVEHKTPFEIVYKSKPSVKHMHPKARAGLFLGYEEVSKAYRLYDIEAGQVVVSRD
VNFDESAFGLSTHISDEDVDDAALDLDALDLDDNDGRRQTSFKQAGKRKSRPSGDDDTAR
ISRPVRHRAGLEEASASDVSSSCRAEPDKEEKSGDQDEDDDSTPPVFWRASANTVEAAAD
LSEPTTFQEAANAASAPSAPIVFKIKRKADGSIEKYKARLVAKGFKKKYGIDYTETFSPV
VKYVTLRMIIAIAKYFGWPLDQLDVVTAFLYGVMKEVVFCVVPEGVELDGGFDCLELVKA
IYGLKQASRVWNETFDEFMCSIGFQVSAFDPCLYIKMVDSHCVLVLVLVYVDDVLITGSL
PELISRTKTDLKTRFEMTDSGKCAFVLGIELVDSPDGSVTMCQRRYVDDILKRFAMDECK
AVVSPVDMSTRLVPSDAATKVNAPFREAVGALMHLMTATRPDIAYAVGYVSRFMENPQEE
HWVAVKRILRYLQGTKTHGICFKPGDMIDFRGYSDTDWAGDLADRKSTSGYKFMLMSAPV
SWGSKKQSSVSLSTSEAEHIALSLAIQEGKWIHRLLCEILAAANETGPELMIREDNQSCI
KMTKNPVNHGRAKHIDIKYHHIRDEVKRGEVKLEYCETSVMLADIMTKALAGPRHTELTA
ALGIHGTSH
Download sequence
Identical sequences H3H6A9
164328.JGI86207 jgi|Phyra1_1|86207|fgenesh1_pg.C_scaffold_536000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]