SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86229
Domain Number 1 Region: 477-633
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.32e-26
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Weak hits

Sequence:  164328.JGI86229
Domain Number - Region: 195-222
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000121
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 
Domain Number - Region: 842-988
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000396
Family Reverse transcriptase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86229
Sequence length 1000
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIEKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEARLVASTLKRQLFSMEMSEGGNVLHHCNEVLNIS
AKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKRQGE
KTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRGRGA
NNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFAH
LIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQI
NKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTVDLHARM
GHAPVEVLRKMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTFELL
HFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAMQTQFAKKVKFVRHDGAREFATN
SLKAFYEVEGIEQQTTVPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTAI
YVKNRLPSPKVEHKTPFEIVYKAKPSVKHMRVFGCQTYILTPKEKRRKWDPKARAGLFLG
YEQVSKAYRLYDIEAGQVVVSRDVNFDESAFGLSAHTSDEDVDDAALDLDALDLDDTDGP
RQTSFKQAGKRKSRPSGDDDTARRSRPVRHRAGLEEASAPDVSSSHRAEPDEEEKSGDQD
EDDDSTPPVFWRASANTVEAAADLSEPTTFQEAVNGPDQVHWRKAIRAELKSMRLRGVFR
AAKLPSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTETFSPVVKYVTL
RMIIAIAKYFGWPLDQLDVVTAFLYGVMKEVVFCVVPEGVELDDGFDCLELVKAIYGLKQ
ASRVWNETFDEFICSISFQVSAFDPCLYIKVVDGHCVLVL
Download sequence
Identical sequences H3H6C8
jgi|Phyra1_1|86229|fgenesh1_pg.C_scaffold_551000002 164328.JGI86229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]