SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI86635
Domain Number - Region: 95-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00171
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86635
Sequence length 114
Comment (Phytophthora ramorum)
Sequence
MEMSEGGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAE
LRSQDVVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTID
Download sequence
Identical sequences H3H7C5
jgi|Phyra1_1|86635|fgenesh1_pg.C_scaffold_948000001 164328.JGI86635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]