SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86740
Domain Number 1 Region: 299-515,543-631
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000000000147
Family Reverse transcriptase 0.047
Further Details:      
 
Domain Number 2 Region: 101-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000017
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86740
Sequence length 648
Comment (Phytophthora ramorum)
Sequence
MMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQFLITALESRADSL
SWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDNKRKGRPVKKTGACHNCGKQG
HWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSTAKPSDMWLVDSGATQH
MTSSKTYMRNYKTMAPVDVHLADDGVVQAVGTGDIVMSMKTPRGMKKGVLTNVWHIPKLS
RNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGALHWRKAIRAELKSMRLRGVFRAAK
LPSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTETFSPVVKYVTLRMI
IAIAKYFGWPLNQLDVVTAFLYGVMKEVVFCVVPEGVELDGGFDCLELVKAIYGLKQASR
VWNETFDEFMCSIGFQVSAFDPCLYIKVVDGHCVLVLVYVDDVLITGSSPELIARTKTDL
KTRFEMTDSGKCAFVLGIELVDGPDGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTR
LVPSDAATKVNAPFREAVGALMHLMTATRPDIAYAVGYVSRFMENPQEEHWVAVKRIFRY
LQGTKTHGICFKPGDKIDFRGYSDADWAGDLADRKSTSGYTFMLMSAP
Download sequence
Identical sequences H3H7L6
jgi|Phyra1_1|86740|fgenesh1_pg.C_scaffold_1179000001 164328.JGI86740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]