SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86757 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86757
Domain Number 1 Region: 376-459
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000209
Family Retroviral integrase, catalytic domain 0.035
Further Details:      
 
Domain Number 2 Region: 95-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000377
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86757
Sequence length 461
Comment (Phytophthora ramorum)
Sequence
MEMSEGGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNWEMSSAE
LRSQDVVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTVDKCWTKQ
KDENRGPRRGANGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGM
WAVDSGATHHICNDKAKFADLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIE
IKNALYVPSMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQT
PHRAANAATSGKTVDLHARMGHAPVEVLRKMVDSDMIKDAKAPSKSSGPSVCRGCQQGKM
VQKPFPSNHDKRRYDTFELLHFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSE
SEDCIKTYVTKVQTQFGKKVKFVRHDGAREFATNSLKAFYE
Download sequence
Identical sequences H3H7N0
164328.JGI86757 jgi|Phyra1_1|86757|fgenesh1_pg.C_scaffold_1251000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]