SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI86826
Domain Number - Region: 267-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000195
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86826
Sequence length 310
Comment (Phytophthora ramorum)
Sequence
MPGMVDYEYDAEGDVRMTVPQPIFEVVAAPELAVWSQAAITTFIRERRQYEAKIAERCST
TGEVQETVARSIRTSLKPRVLEHVTHYILKKEVESVTDAMLLAEMKRKVGGMVNDRVPDV
SRLFAELKMDLEEVDVEARIAKYFMGFDRLVEDNGLTGMLGRGPAVGEAGRQRLKMRCKL
LLTHVTPEILKVDLTRLVELTHREAKVDDLALHDLMIERATRQQQYYLMQNEMKQSSSLR
PKEDGGAAAKAHGRPAKQLPKPSSIQGGGRGAAGPRKPPRDGCLVCKGPHWARDCPTATA
EQKANVEKML
Download sequence
Identical sequences H3H7U2
jgi|Phyra1_1|86826|fgenesh1_pg.C_scaffold_1311000001 164328.JGI86826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]