SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI86875 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI86875
Domain Number 1 Region: 435-529
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000228
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 2 Region: 201-235
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000576
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI86875
Sequence length 538
Comment (Phytophthora ramorum)
Sequence
MNPSTDTKFKVEPFDGSNYSLWSYKMKMYLMSKGLWEAVSGEAGSTAKEQQAHAAIVLNL
NDLQLMHVVTSTTAKEAWDTLKKFHKTQDMANRLWLKEKFSAFKFTASSVGKHVTELEKL
VMEMKNAGCEPTEEDVCATMLRSLPSSYEALVQAFRMSVSEFKLADLVSKLIAEEVRQKD
SNRIEEATAFLAGKGNGKQQQKKKNARGMRKKGPFGKCFNCGKPGHYARDCRSEASPDED
VQDQSNVAFHATEAFASECWVMDSSASAHMCKTRDAFQEYSGVKTARTISSAKSSASAKI
LGDGTVVLRVWTGNLFSLTAATARGMTVTMDSEQCVVKRGGQVVATGRKQGKLMFLNIEG
GDECHAAEDNMDLWHRRLGHASFGTLNSMIKDGKLKGALAEPGTVCGVCATAKQARKPFK
STREGLEARESARKDTTVCSDVLGPVTPASKSGYKYIVSFIMMKSRFVTIYPLRKKSEVC
EAFKKFLKEAETSAGIKVKVLRSDNGGEYCNVGMVALCDEKTSSRCLTTRNRTAWQSG
Download sequence
Identical sequences H3H7Y4
164328.JGI86875 jgi|Phyra1_1|86875|fgenesh1_pg.C_scaffold_1347000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]