SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87041
Domain Number 1 Region: 501-965
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2e-78
Family Reverse transcriptase 0.00021
Further Details:      
 
Weak hits

Sequence:  164328.JGI87041
Domain Number - Region: 275-308
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0298
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87041
Sequence length 1058
Comment (Phytophthora ramorum)
Sequence
MPNSTQYENDGDVIMTPAHQPVFEFLHAPKLEGWGQDALVTWKKQREQYEECIRQRCVES
GERPEVAMRPIKLAFEPKLLEALCLYELQKPVDDVMDSELRALINQRVQSVKNAQVPDLD
ALFKKHLNVDMHEDDIDARVLKYFRDFSDLVEKNGLGDILGVGDPLKPAYNERMKLRCNF
LVDNLEPAILRDEVRRHTKFVDQEAKRNDFVLFRVIKEKALAQHKYHVLTRDQKGKLNSD
KRDKATTSSDKSQSNGGKKWPRPTGTGGARSSGPSKTTETKIKPPRTGCWHCKGDHWLRD
CPTATEADKAVAVERMKALRNGSKAKKVTPSLAVGEVIVNGLISLPYCADSGATSSYIAR
QSVEELIDLGAEVTVKPLPEPMEVTVAGGAVIVCHDSVKLDLRLQTVAGPVHLTEVTCTV
FEGQEEEFILGNDMLVSLGIDVNAQLSQLAGGHVMQDNDPFEPEEPQGVDPSDVRHLLEA
MVTAAGENGFPLEYLPPLLDLVMEFEDVFRIELGNDPPADVEPLRITIRAGSQPYRTRPR
RYAPAQSDFLRAHTQQLLDMGFIRRNQQSHWACAAVPVPKANRPSTFRLTIDYRPVNAIT
VPIAGTAPDLAAAARNVRGVCGFANFDMTNGFTQLPLHPDSQEVMSFVTDDAVFTPTRVP
QGATDSALHFQNQMQVVFRKMLYKNLLVWIDDLLVYARSPVEFIAALRQFFECVQGARLK
LSVLKSCLFQTATKWCGKIFSGEGIAHDPARVSGLQSLPLPVTAADLQQFLCAAGWLRDS
IMDYSRVMQPLHILLEAALQQVGRTKRLAAGFTLSWNDGDKAAFTTARNLLATTQMLHFP
DDSASLCVFSDASERGWGLLVSQVREWNDALPAVEQQHELLLCKSGVFSDTEQRWSIIEK
EAFPIIFAARNLGYLLVRRGGFRLYCDHKNLVFVFAPDKEVKRHVRGKLQRWALSLTGLA
FQVEHIDGTDNLWADLLSRWGLPVEEVGVSMQCKFITRSRARELAEAADAEESESVVEPE
MRVDQDHTHRVDQVHRGHELPEHSEVLVDPNHAEPVDQ
Download sequence
Identical sequences H3H8C5
164328.JGI87041 jgi|Phyra1_1|87041|fgenesh1_pg.C_scaffold_1486000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]