SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87105
Domain Number 1 Region: 266-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87105
Sequence length 321
Comment (Phytophthora ramorum)
Sequence
MERSEFPHLNDSQFESVRKMGGIFGRDVLRGLASVTPAEQVERVNAFDTYERELIAHVQG
NLQASVAEPKPVQPKPLRLAVPAFEGKEGENLHFWIREVEIAMRAGLISDQGLRVAFGLS
NLSGRAKNWAYTLETTSPGCFASWEQLCERLRAAFLPANDAFRQRSRFLACKQGKRELYE
YVQEMRTLASSLVGNPLPEDVKTTVFTDGLKVGPARTQLFRVHASTMEEAIKIALQEEYS
HKQAGTPVVVQLVVANNEPEPMDLSSAELGSVRCYKCGGLGHYQRVCPSTGVGKSPSLKP
RGPNGRWRKPRPGGRGNSGHQ
Download sequence
Identical sequences H3H8I4
jgi|Phyra1_1|87105|fgenesh1_pg.C_scaffold_1567000001 164328.JGI87105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]