SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87150
Domain Number 1 Region: 287-439
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.99e-26
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-35
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000586
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87150
Sequence length 442
Comment (Phytophthora ramorum)
Sequence
MPFAKAFNTDRESRQCTYCGKLGHTIDKCLTKQKDENRGPRRGGNDNGNGRGRGANNAQW
RNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERN
EGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSTNLLSVPQINKSGL
FQVVFDGTQMRVANKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTVDLHARMGHAPV
EVLRKMVDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTFELLHFDIC
GPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVKFVRHDGAREFAT
NSLKAFYEVEGIEQQTMVPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTA
IYVKNRLPSPKVEHKTPFEIVY
Download sequence
Identical sequences H3H8M1
jgi|Phyra1_1|87150|fgenesh1_pg.C_scaffold_1612000003 164328.JGI87150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]