SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87153 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87153
Domain Number 1 Region: 609-769
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.16e-30
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 2-61,97-281
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000302
Family Reverse transcriptase 0.071
Further Details:      
 
Domain Number 3 Region: 328-359
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000481
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87153
Sequence length 781
Comment (Phytophthora ramorum)
Sequence
VALYVDDLILASSNDELLESTKYALSKRFEMTDLGELEYFLGMEIKNNRDSGKATVRQTK
FFKSILTKFGMQDSKPVKTPQDPGLKLTKNMCEGGCQHEDTMKNVPYRSAVGALMYLMVA
TRPDLAAAVGVLSQFSADPCPTHWQALKRVLRYLQATPTHGLEFSREDSLGMCGYSDADW
AGDIESRRSTSGYAFMMNGGCISWRSKKQRTVALSSTEAEYMALSEATQEAVWLKVFLCE
LGEMASDEAVKIYEDNQGSIALAKNPQFHKRTKHIDIRYHFVREKVEDGQVVLQYVSTTD
MLADMMTKAIPATQFSVLRTKLGIQGRGQAFNTDRESRQCTYCGKLGHTIDKCWTKQKDE
NRGPRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAV
DSGATHHICNDKAKFAHLVERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKN
ALYVPIMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQR
SANAATSGKTVDLHARMGHAPVEVLRKMIDNGMIKDAKAPSKSSGPSVCRGCQQGKMVQK
PFPSNRDKRRYDTFELLHFDMCGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSESED
CIKTYVTKVQTQFGKKVKFVRHDGAREFATNSLKAFYEVEGIEQQTTVPYAHQTNGTAER
AIRTIVTIGRSMLHHAKLDKCFWAEAAMTAIYVKNRLPSPKVEHKTPFEIVYKSKPSVKH
M
Download sequence
Identical sequences H3H8M3
164328.JGI87153 jgi|Phyra1_1|87153|fgenesh1_pg.C_scaffold_1614000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]