SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87173
Domain Number 1 Region: 138-269
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.08e-21
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 478-670
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000823
Family Reverse transcriptase 0.057
Further Details:      
 
Domain Number 3 Region: 40-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000858
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87173
Sequence length 749
Comment (Phytophthora ramorum)
Sequence
MSSAELRSQDVVRVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDK
CWTKQKDENRGPRRGGNGDGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGK
DMLGMWAVDSGATHHICNDKAKFAHLIERNEGELSTQFGKKVKFVRHDGAREFATNSLKA
FYEVEGIEQQTTVPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTAIYVKN
RLPSPKVEHKTPFEIVYKSKPSVKHMRVFGCQTYILTPKEKRRKWDPKARAGLFLGYEQV
SKAYRLYDIEAEQVVVSRDVNFDESAFGLSTHTSDEDVDDAALDLDALDLDDNDGPRQTS
FKQAGKRKSRPSGDDDTARRSRPVRHRAGLEEASAPDVSSSRRAEPDEEEKSGDQDEDDD
STPPVFWRASANAVEAAADLSEPTTFQEAVNGPDQVHWRKAIRAELKSMRLRGVFRAAKL
PSGQRAIGTKWVFKIKRKADGSIEKYKARLVAKGFKQKYGIDYTETFSPVVKYVTLRMII
AIAKYFDWPLDQLDVVTAFLYGVMKEVVFCVVPEGVELDDGFDCLELVKAIYVSAFDPCL
YIKVVDGQCVLVLVYVDDVLITGSSPELISRTKTDLKTRFEMTDSGKCAFVLGIELVDGP
DGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTRLVPSDAATKVNAPFREAVGALMHL
MTATRPDIAYAVGYVSRFMENPQEEHWVA
Download sequence
Identical sequences H3H8N6
164328.JGI87173 jgi|Phyra1_1|87173|fgenesh1_pg.C_scaffold_1632000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]