SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87214
Domain Number 1 Region: 487-604
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.81e-21
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 610-671,699-885
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000129
Family Reverse transcriptase 0.046
Further Details:      
 
Domain Number 3 Region: 211-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000984
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87214
Sequence length 893
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQD
VVKVLTNEHIKRQGEKTATVKTEDAVKAFNTDRESRQCTYCGKLGHTVDKCWTKQKDENR
GPRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDS
GATHHICNDKAKFAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNAL
YVPSMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSA
NAATSGKTVDLHARMGHAPVEVLRKMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPF
PSNRDKRRYDTFELLHFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCI
KTYVTKVQTQFGKKVKFVRHDGAREFATNSLKAFYEVEGIEQQTTVPYAHQTNGTAERAI
RTIVVDGQCVLVLVYVDDVLITGSSHELISRTKTDLKTRFEMTDSGKCAFVLGIELVDGP
DGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTRLVPSDTATKVNAPFREAVGALMHL
MTATRPDIAYAVGYVSRFMENPQEEHWVAVKRIFRYLQGTKTHGICFKPGDKIDFRGYSD
ADWAGDLADRKSTSGYTFMLMSAPVSWGSKKQSRVSLSTSEAEYIALSLAIQEGKWIHRL
LCEILAAANETGPELMIREDNQSCIKMTKNPVNHGRAKHIDIKYHHIRDEVKR
Download sequence
Identical sequences H3H8S0
jgi|Phyra1_1|87214|fgenesh1_pg.C_scaffold_1680000001 164328.JGI87214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]