SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87240
Domain Number 1 Region: 643-770
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-20
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 195-370
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000000845
Family Reverse transcriptase 0.016
Further Details:      
 
Domain Number 3 Region: 382-409
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000712
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87240
Sequence length 770
Comment (Phytophthora ramorum)
Sequence
VFGCHAYVHVPKAKRTKFDARSVRCRFLGYSEHEKAYRFEELESSRVLVSRDAQFMEDVF
DSGRRDYHQREVVVIQDEETTDQDSSQSDEDDNEEEEEEEAARDEDVGPGNKRHPRTQSL
EEVTEVPSAKRYASQSRHQTLDEMSAAAQESQDFEATYVVDSVGEMPTTFKSAMESSDAV
KWKEACDSECDSLLKNDTWDVVPLPKGRKAIGCRWVFRVKENQAGEIERFKARLVAKGFS
QKYGIDYDETFAPVAKFTSIRIVLSLAAKYGLKLHQMDVKTAFLNGVLDEDIYMAQPDGY
VDEDHPDHVCKLKRSLYGLKQSPRMWNQTIDDFMLKLGFKKCESDHCIYLKHVVKVLTNE
HIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTVDKCWTKQKDENRGPRRGGNG
NGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICN
DKAKFAHLVERNEGELSVADGNKAAIMVVLPNGDERDIEIKNALYVPSMSKNLLSVPQIN
KSGLFQVVFDGTQMRVAHKASKQVVAAANLTPQRSANAATSGKTVDLHARMGHAPVEVLR
KMIDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTFELLHFDMCGPME
EESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFGKKVKFVRHDGAR
EFATNSLKAFYEVEGIEQQTTVPYAHQTNGTAPRAIRTIVTIGRSMLHHA
Download sequence
Identical sequences H3H8U2
jgi|Phyra1_1|87240|fgenesh1_pg.C_scaffold_1710000001 164328.JGI87240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]