SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI87248
Domain Number - Region: 296-319
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0173
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87248
Sequence length 371
Comment (Phytophthora ramorum)
Sequence
MPKRRADDSSDEEESSEYSKPMPVPIFAPILPPRLSSISHKALVKWDKLRMEYEAKMRAR
CRSSGEDYNLVTQNVKESFDLRLLETFCALRLRKDVADVTEGQLIAEIKHLLGKVKNDDL
PDIKTLCAKELRMDLSETDVDARVLAYFQRFHEVVLENGLEEVFSGDDGEKEKCKRLVSC
LAPPVLKADVKSAVRWTNKEAGKSIQKLYTLIYEKAVEHERHFQQNKRMRLMVKDKISLP
KSAKNVEKSTTAHSKKPPRNDSGKRFLSKKTDTKVEKKIDQKTDKTFKPSISRKEPPSPC
PKCQEMHWLSDCTKATDAEKIVLRQKLREANKARQSRVKRLKELMPPTSRTVTINGVLDL
PCCPDTGSDYT
Download sequence
Identical sequences H3H8U8
164328.JGI87248 jgi|Phyra1_1|87248|fgenesh1_pg.C_scaffold_1723000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]