SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI87502
Domain Number - Region: 446-468
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0392
Family Retrovirus zinc finger-like domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87502
Sequence length 470
Comment (Phytophthora ramorum)
Sequence
MTEVAAAQLLATVQQPFPQNQEKHVKRDNGAEDAAAAQSVQATQGATTRTFVSRAQSASR
TQGTSRAQGASSAEQTPHSGSRRSDDKRKTPKKEKRQDASPPADPDPSGDSSSEDSSSSE
SDYDFGQDADSNLTAAKTPEGTTLLTFRPYINSHTLSEFDTKAAIRERVHWWEQFANLAA
QGAWSNKMRIQELKLKLSGAARDWFNQLPKHTQRDWKELATAFRKKYCKARASYSERYYT
MEMRSSESALDFFYRLNSAAGKADIDFRKSTKRLEKHIRRFITKLKETRLKTSLQGQRFK
SISDLEYALEQDEEVWTQNERDAATSRNRDFRAGNLPNPGRPRPKRFERAYLTQNADFGV
KMSEYPEELPRMQDAVEESGVSAQGVDPGSQDTRDDGGALNAGPSGAEWTQTLTNEVYRV
MDNMGWRPPGHAPHGNPVPNSGRRENPNWDKYCEKCHKWGHPEESCWKDI
Download sequence
Identical sequences H3H9H2
164328.JGI87502 jgi|Phyra1_1|87502|fgenesh1_pg.C_scaffold_2081000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]