SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87506 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI87506
Domain Number - Region: 341-383
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0012
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87506
Sequence length 430
Comment (Phytophthora ramorum)
Sequence
MERFLKEQQAVSTTPVVDQTKPPGAQDVDMESVESNRRDHSHPSEYDPDDLGVDVTPRAA
VASAGTTGGGTLSATRIRVSAISELKEFSGKDNDEDRARSWFGKLKSAFVRDQAPDGEKC
LVFGDLLTGPARNWYRQLSRTTRGNWKSLSKNFQTQYCGRGVSVARQYYHARKRSDESPL
EYLHRLNVAGLRAQLSIKDGSIEVRREHVDHFIETLDDRDLASQLALLRIPDADTLEETL
RSRQRAKARQGKTVYGSIKPKQKSPTGITPSANARAVRAIRATVNSSDSELETSGSEGEG
DLRKVYFAATPDQPTRSHSDQEQRRPSRDSNDRRLDRPAGSLEGEAPRKPCSHCGSSKHT
DLGCWKRLTCEKCGKKGHPTDRCLFVCKACGEIHGAGECPMEEFYNLIRQWYNPTKHGGM
LPQAAEKMLN
Download sequence
Identical sequences H3H9H6
jgi|Phyra1_1|87506|fgenesh1_pg.C_scaffold_2086000001 164328.JGI87506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]