SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87520
Domain Number 1 Region: 101-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000471
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87520
Sequence length 300
Comment (Phytophthora ramorum)
Sequence
MMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQFLITALESRADSL
SWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMVNNNKRKGRPVKKTGACHNCGKQG
HWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSAAKPSDMWLVDSGATQH
MTSSKTYMRNYKTMAPVDVHLADDGVVQAVGTGDIVMSMKTPRGMKKGVLTNVWHIPKLS
RNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGAREGKGLFKLCIVVKKAPRAAAVYR
Download sequence
Identical sequences H3H9I7
jgi|Phyra1_1|87520|fgenesh1_pg.C_scaffold_2107000002 164328.JGI87520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]