SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87525 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87525
Domain Number 1 Region: 7-36
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000196
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87525
Sequence length 130
Comment (Phytophthora ramorum)
Sequence
MTRDNKRKGRPVKKTGACHNCGKQGHWIAECPSRIQNDAERYRSQRANVAQDEEDPGDYL
FSVGRTSSAAKPSDMWLVDSGATQHMTSSKTYMRNYKTMAPVDVHLADDGVVQAVGTGDI
VMSMKTSRGM
Download sequence
Identical sequences H3H9J2
164328.JGI87525 jgi|Phyra1_1|87525|fgenesh1_pg.C_scaffold_2113000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]