SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87550 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87550
Domain Number 1 Region: 216-246
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000589
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87550
Sequence length 255
Comment (Phytophthora ramorum)
Sequence
MDATPTTTARINKFNGTNFHTWKFKMQMVLEERELWEVTSGEVKLEHCTTTADQATFKRK
SRKALAIICLAMEDSQLPLVRSAKDAHDAWSRLEGHFEKKSLANKLFLRRRFFTTMMDEG
DDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQFLITALESRADSLSWELV
TSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMVNNNKRKGRPVKKTGACHNCGKQGHWIAE
CPSRVHNDAERYRSQ
Download sequence
Identical sequences H3H9L2
164328.JGI87550 jgi|Phyra1_1|87550|fgenesh1_pg.C_scaffold_2152000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]