SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87571 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87571
Domain Number 1 Region: 389-583,619-738
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.23e-26
Family Reverse transcriptase 0.033
Further Details:      
 
Domain Number 2 Region: 235-265
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000196
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87571
Sequence length 741
Comment (Phytophthora ramorum)
Sequence
MSPNPVFPAQDQDPDYAFAMDATPTTTARINKFNGTNFHAWKFKMQMVLEERELWEVTSG
EVKLEHCTTTAGQATFKRKSRKALAIICLAMEDSQLPLVRSAKDAHDAWSRLEGHFEKKS
LANKLFLRRRFFTTMMEEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESY
QFLITALESRADSLSWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDNKRKGRP
VKKTGACHNCGKQGHWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSTAK
PSDMWLVDSGATQHMTSSNKYMRNYKTMAPVDVHLADDGVVQAVGTGDIVMSMKTPRGMK
KGVLTNVWHIPKLSRNLFSVGRFTKDVGLIERFKARLVAKGFSQKYGIDYDETFAPVAKF
TSIRIVLSLAAKYGLKLHQMDVKTAFLNGVLDEDIYMAQPDGYVDEDHPDHVCKLKRSLY
GLKQSPRMWNQTIDDFMLKLGFKKCESDHCIYLKRDGQDMIFVALYVDDLILASSNDELL
ESTKHALSKRFEMTDLGELEYFLGMEIKNDHGSGKVTVRQTKFLQFILTKFGMQDSKPVK
TPQDPGLKLTKNMCEGGCQHEDTMKNVPYRSAVGALMYLMVATRPDLAAAVGVLSQFSAD
PCPTHWQALKRVLRYLQATPTHGLEFLREDSLGMCGYSDADWAGDIESRRSTSGYAFMMN
GGCISWRSKKQRTVALSSTEA
Download sequence
Identical sequences H3H9M9
164328.JGI87571 jgi|Phyra1_1|87571|fgenesh1_pg.C_scaffold_2184000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]