SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87599
Domain Number 1 Region: 282-390
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-26
Family Retroviral integrase, catalytic domain 0.008
Further Details:      
 
Domain Number 2 Region: 451-626
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000012
Family Reverse transcriptase 0.048
Further Details:      
 
Domain Number 3 Region: 28-57
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000563
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87599
Sequence length 693
Comment (Phytophthora ramorum)
Sequence
MKRKEQGGGGVDGAAHGQGQAFMTRDNKRKGRPVKKTGACHNCGKQGHWIAECSSRVQND
AERYRSQRANVAQDEEDPGDYLFSVGRTSSTAKPSDMWLVDSGATQHMTSSKTYMRNYKK
MAPAVGTGDIVMSMKTPRGMKKGVLTNVWHIPKLSRNLFSVGRFTKDVGPVTFESDGCFA
DNKGLKWQLGAREGKGLFKLCMTPMMPDEANAASSKDRQGDTTSYLWHLRLGHIGHGGLD
AIVKKSYGVGIDMTSVKQWELCDGCALGKQTRVSYMKSSPNRAKHVLEVVHSDVCGPMQT
PTFGGKRYFVTFIDDKSHFCVVYLLRNKSEVAAKFAEFVAFAETQTGKRVQTLRSDNGGE
YTSGAMAKFCADRGIVQKFTPPYTPQLNGIKNXRDSGKVTVRQTKFLKSILTKFGMQDSK
PVKTPQDAGLKLTKNMCEGGCQHEDTMKNVPYRSAVGALMYLMVATRPDLAAAVGVLSQF
SADPCPTHWQALKRVLRYLQATPTHGLEFSREDSLGMCGYSDADWAGDIESRRSTSGYAF
MMNGGCISWRSKKQRTVALSSTEAEYMALSEATQEAVWLKVILCELGEMASDEAVKIYED
NQGSIALAKNPQFHKRTKHIDIRYHFVREKVEDGQVVLQYVSTTDMLADMMTKAITAVQF
GVLRSKLGIQGAIAVESSGSVVKKAPRAAAVYR
Download sequence
Identical sequences 164328.JGI87599 jgi|Phyra1_1|87599|fgenesh1_pg.C_scaffold_2230000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]