SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87647
Domain Number 1 Region: 318-579
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.82e-30
Family Reverse transcriptase 0.0077
Further Details:      
 
Weak hits

Sequence:  164328.JGI87647
Domain Number - Region: 267-301
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000523
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87647
Sequence length 702
Comment (Phytophthora ramorum)
Sequence
MPGMVDYEYDAEGDVRMTVPQPIFEVVAAPELAVWSQAAITTFIRERRQYEAKIAERCST
TGEVQETVARSIRTSLKPRVLEHVAHYILKKEVESVTDAMLLAEMKRKVGGMVNDRVPDV
SRLFAELKMDLEEVDVEARIANYFMGFDRLVEDNGLTGMLGRGPAVGEAGRQRLKMRCKL
LLTHVTPEILKVDLTRLVELTHREAKVDDLALHDLMIERATRQQQYYLMQNEMKQSSSLR
PKEDGGAAAKAHGRPAKQLPKPSSIQGGGRGAAGPRKPPRDGCLVCKGPHWARDCPTATA
EQKANVEKMLREKRSPFLESLGKFFAILRQRKLKLNARKCKLFAKRVKWCGKVIDGAGVE
HDPERLAALRQMPLPPTGAALQHFLCALNWLRDSMVDYARTTAPLQEKLERVMQSRGRRK
AQLSGAVVEWSKEEAETFRKTLEMIERSCKLAFPDKRATVCLFSDASLTGYALVLTQVLN
WQDGVPVEEQQHELLICRGGLFKNAQRNWSIVEKEGYPIVKACGDLDYMLTREKGFHVYC
DHSNLIQIFTPDREVKQHVKGKLQRWALKLVGCRYVIHHIAGENNLWADIISRWGQPAPP
DTVKSLAVKRVTTRSAQALSELRPLQDDEFTWPTRSEIVRAQHQYEGDAPDSAVMTSDGI
EVDDKLWLPAQAKAVLKRLFVVAHCGPQGHRGVNVMVELLDR
Download sequence
Identical sequences H3H9U6
jgi|Phyra1_1|87647|fgenesh1_pg.C_scaffold_2318000001 164328.JGI87647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]