SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87665
Domain Number 1 Region: 96-122
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000691
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87665
Sequence length 350
Comment (Phytophthora ramorum)
Sequence
MEMSEGGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAE
LRSQDVVKVLTNEHIKRQGEKTATVKTEDAVKAFNTDRESRQCTYCGKLGHTVDKCWTKQ
KDENRGPRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGM
WAVDSGATHHICNDKAKFAHLVERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIE
IKNALYVPSMSKNLLSVPQINKSGLFQVVFDGAQMRVAHKASKQVVAAANLVDGLYWLQT
PQRAANAATSGKTVDLHARMGHAPVEVLRKMVDNDMIKDAKAPSKSSGPS
Download sequence
Identical sequences H3H9W3
164328.JGI87665 jgi|Phyra1_1|87665|fgenesh1_pg.C_scaffold_2350000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]