SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87687 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87687
Domain Number 1 Region: 311-535
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.37e-24
Family Reverse transcriptase 0.032
Further Details:      
 
Domain Number 2 Region: 5-25
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87687
Sequence length 565
Comment (Phytophthora ramorum)
Sequence
TKPFGACHNCGKQGHWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSTAK
PSDMWLVDSGATQHMTSSNKYMRNYKTMAPVDVHLADDGVVHAVGTGDIVMSMKTPRGMK
KGVLTNVWHIPKLSRNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGAREGKGLFKLC
MTPMMPDEANAASSKDRQGDTTSYLWHLRLGHIGHGGLDAIVKKSYGVGIDMASVMQXEL
CDGCALGKQTRSRHQTLDEMSAAAQESQDFEAAYVVDSVGEMPTTFKSAMESSDAVKWKE
ACDSECDSLLKNDTWDVVPLPKGRKAIGCRWVFRVKENQAGEIERFKARLVAKGFSQKYG
IDYDETFAPVAKFTSIRIVLSLAAKYGLKLHQMDVKTAFLNGVLDEDIYMAQPDGYVDED
HPDHVCKLKRSLYGLKQSPRMWNQTIDDFMLKLGFKKCESDHCVYLKRDGQDMIFVALYV
DDLVLASSNDELLDSTKHALSKRFEMTDLGELEYFLGMEIKNDRDSGKVTVRQTKFLKSI
LTKFGMQDSKPVKTPQDPGLKLTKN
Download sequence
Identical sequences H3H9Y1
jgi|Phyra1_1|87687|fgenesh1_pg.C_scaffold_2399000001 164328.JGI87687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]