SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87702
Domain Number 1 Region: 296-536
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-68
Family Reverse transcriptase 0.00026
Further Details:      
 
Weak hits

Sequence:  164328.JGI87702
Domain Number - Region: 178-204
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00293
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87702
Sequence length 537
Comment (Phytophthora ramorum)
Sequence
METSSYSGEGPDRLPLNRWFREIDIAIASRLIEAPSAKVNFLLSRLSGKAKEWVLGKLVV
DQYAFPTLEALQSDLRLAFEPPQDESRVRATFFALKQGKMAMRDYVQRTRHLASCIVTKP
IDMASQVHVFVFAFALALREDYLVTSSYAKTMPAQTRVLVPEPMEIDAIEASQNRRWSSS
GRGRGGQNDLSLNCFRCGKPGHRAAVASPPRDAKSITDLPGLSWKSFLRDLKAGDIEQVC
LITDANPVSDETNAIAHDDTSSRPKSAEPKSAREERFAAQSWESLKASGNPVYETAREFA
DVFPDKIPAELPADRGVRHEIDLVPGSKYCVTRQWPLPRDQVKAIDDFFEGRRQAGHVRE
SISPHSSLTFCVKKATGGWRIVHAFNKLNDATIPAQTPIPRKDMVLDSMSGSVIYSAIDL
TDGFYQILMRESDVPLTAVSTPSGMLWEWLVMPQGLKNAPATFNRMVSHVLRPLRDFAPS
YFDDIFVHSHAEEGLSAIDVHLRHLRQVFQVMRENKLYANLKKCVFCAPEIPVLGCY
Download sequence
Identical sequences H3H9Z5
164328.JGI87702 jgi|Phyra1_1|87702|fgenesh1_pg.C_scaffold_2430000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]