SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87708 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87708
Domain Number 1 Region: 101-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000523
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number 2 Region: 401-501
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000102
Family Reverse transcriptase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87708
Sequence length 517
Comment (Phytophthora ramorum)
Sequence
MMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQFLITALESRADSL
SWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDNKRKGRPVKKTGACHSCGKQG
HWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSTAKPSDMWLVDSGATQH
MTSSKTYMRNYKTMAPVDVHLADDGVVQAVGTGDIVMSMKTPRGMKKGVLTNVWHIPKLS
RNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGAREGKGLFKLCMTPMMPDEANAAKE
EEEEEEAARDEDFGPGNKRHPRTQSLEEVTEVPSAKRYASQSRHQTLDEMSAAAQESRDF
EAAYVVNSVGEMPTTFKSAMESSDAVKWKEACDSECDSLLKNDTWDVVPLPKGRKAIGCR
WVFRVKENQAGEIERFKARLVAKGFSQKYGIDYDETFAPVAKFTSIRIVLSLAAKYGLKL
HQMDVKTAFLNGVLDEDIYMAQPDGYVDDGRYGSWTP
Download sequence
Identical sequences H3H9Z9
jgi|Phyra1_1|87708|fgenesh1_pg.C_scaffold_2446000001 164328.JGI87708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]