SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87731
Domain Number 1 Region: 101-131
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000864
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  164328.JGI87731
Domain Number - Region: 367-406
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000192
Family Retroviral integrase, catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87731
Sequence length 406
Comment (Phytophthora ramorum)
Sequence
MMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQFLITALESRADSL
SWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMVNNNKRKGRPVKKTGACHNCGKQG
HWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSAAKPSDMWLVDSGATQH
MTSSKTYMRNYKKMAPVDVHLADDGVVQAVGIGDIVMSMKTPRGMKKGVLTNVWHIPKLS
RNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGAREGKGLFKLCMTPMMPDEANAASS
KDRQGDTTSYLWHLRLGHIGHGGLDAIVKKSYGVGIDMTSVKQWELCDGCALGKQTRVSY
MKSSPNRAKQVLEVVHSDVCGPMQTPTFGGKRYFVTFIDDKSHFCV
Download sequence
Identical sequences H3HA20
jgi|Phyra1_1|87731|fgenesh1_pg.C_scaffold_2503000001 164328.JGI87731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]