SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87741
Domain Number 1 Region: 386-492,520-706
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000182
Family Reverse transcriptase 0.047
Further Details:      
 
Domain Number 2 Region: 317-415
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000778
Family Retroviral integrase, catalytic domain 0.042
Further Details:      
 
Domain Number 3 Region: 40-67
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000795
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87741
Sequence length 714
Comment (Phytophthora ramorum)
Sequence
MSSAELRSQDVVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDK
CWTKQKDENRGPRRGGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGK
DMLGMWAADSGATHHICNDKAKFAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGD
ERDIEIKNALYVPIMSKNLLSVPQINKSGLFQVVFDGTQMRVAHKASKQVVAAANLVDGL
YWLQTPQRSANAATSGKTVDLHARMGHAPVEVLRKMIDNDMIKDANAPSKPSGPSVCRGC
QQGKMVQKPFPSNRDKRRYDTFELLHFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCL
RAKSESEDCIKTYVTKVQTQFGKKVKFAIYGLKQASRVWNETFDEFMCSIGFQVSAFDPC
LYIKVVDGQCVLVLVYVDDVLITGSSPELISRTKTDLKTRFEMTDSGKCAFVLGIELVDG
PDGSVTMCQRRYVDDILKRFAMDECKAVVSPVDMSTRLVPSDAATKVNAPFREAVGALMH
LMTATRPDIAYAVGYVSRFMENPQEEHWVAVKRIFRYLQGTKTHGICFKPGDKIDFRGYS
DADWAGDLADRKSTSGYTFMLMSAPVSWGSKKQSSVSLSTSEAEYIALSLAIQEGKWIHR
LLCEILAAANDTGPELMIREDNQSCIKMTKNPVNHGRAKHIDIKYHHIRDEVKR
Download sequence
Identical sequences H3HA29
jgi|Phyra1_1|87741|fgenesh1_pg.C_scaffold_2528000001 164328.JGI87741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]