SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87743
Domain Number 1 Region: 354-497
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.45e-38
Family Reverse transcriptase 0.00049
Further Details:      
 
Weak hits

Sequence:  164328.JGI87743
Domain Number - Region: 259-273
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0205
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87743
Sequence length 497
Comment (Phytophthora ramorum)
Sequence
MDRSEFPHLNDSQFESVRKMAGIFGMDALQSLAAATPAEQLERAPVAERKPVQPKPLRLK
VNPYEGKEGENLHFWVREVELATDAALVSDERLRVAFALSHLSGRAKSWAYTREATTPGC
FASWAQLCEQLRAAFLPANYEYRQRSRFLACKQGRRELHEYIQEMRELTASLVGNPLHEH
IKVTVFMDGLRVGPARTQLFRVQASTLEEAIQIALQEEYSHRQARTPATAWLGGSTQGGP
QSRGPFNGPVPMDLSLAEQHDIRCFGCGKLGHMKPLPEVSELLNLEEMSMDDFLAQLKAE
AIAEMVLLKPEASPEELSSSSVMDKDVLDELGKKRATRTGSAILENPKDPVYPLVKEFSD
VVSKDPPSQLPPDRGVRHEIDLVPGTKYCVTRQWPLPREQCKVIDAFFAAKAKAGMVRES
KSPHSTPTFCVRKPNGKWRLVHAYNKLNSATVPAQTPIPRKDVLLNNMAGCELYSALDLV
DGYYQILMRERDIPLTA
Download sequence
Identical sequences H3HA31
jgi|Phyra1_1|87743|fgenesh1_pg.C_scaffold_2542000001 164328.JGI87743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]