SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87917
Domain Number 1 Region: 358-518
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-45
Family Retroviral integrase, catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 116-154
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000488
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87917
Sequence length 695
Comment (Phytophthora ramorum)
Sequence
MHNRVTMTRRLHEFKMEGGVTMAKHLDDFDELIVGLQTLGEPLDEARQLVILLSSLPTEY
ELICSIVENAKDFTLIEVKEKLLKEYERLDKKEGAERALKATANGSKFRCAKTFRGGKGS
KAFGSRKNGGFKGKCFNCGQVGHMKRDCPDPNAGNNDDDAVFAVGKSRSAAWLIDSGATA
HMTPHRNDLFEYKDLDSDVEVTIADGKKIRVVGTGSVRLTGIDGTRIKMIDVLFIPGLDR
QLLSVSRLAERGMIVEFQKKSCTIWNKSKAIALGKKVGKAYMLDCEKDMAHYVEYAGVDS
EWELWHARMGHLNKDALAKTQRATTGMPTLDHKSMTICGGCMKGKQTVAHFPSRSLSKTT
KVLQLVHTDVMGPMKTKSKGGARYVLTFVDDYSKYIVAYFITKKSEVPVKFKTFMNLYEN
QWGERIKCLRSDNGTEFVNKEMDRLCALNGIVHQKTVPYSPQQNGVAERMNRTIMEKARS
MLYYKGITTMWWAEAVSTSVYLINRSTTSTHSSMTPHELAFRDKPRLDHLRVFGSVGYAH
VDKAKRTKLEPKSFKCMFLGYAENSKGYRVYDLESNKVKVTRSLKLDEREVDGIYESTPT
ESTTDIHSTEDVDEVVQLEQEQQSATQAPVGSVEDNHEEDAAMPEAESDDSMRHGLTTYR
TTPGADFSDDLVFHPERERVRRPRDLILALEDEYK
Download sequence
Identical sequences H3HAJ2
164328.JGI87917 jgi|Phyra1_1|87917|fgenesh1_pg.C_scaffold_2853000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]