SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI87919 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI87919
Domain Number 1 Region: 415-485
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000152
Family Retroviral integrase, catalytic domain 0.042
Further Details:      
 
Domain Number 2 Region: 138-165
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000586
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI87919
Sequence length 500
Comment (Phytophthora ramorum)
Sequence
MDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSEGGNVLHHCNEVL
NISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKR
QGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRG
RGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAK
FAHLIERNEGELSVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSV
PQINKSGLFQVVFDGAQMRVAHKASKQVVAVANLVDGLYWLQTPQRSANAATSGKTVDLH
ARMGHAPVEVLRKMVDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTF
ELLHFDICGPMEEESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFG
KKVKFVRVVKKAPRAAAVYR
Download sequence
Identical sequences H3HAJ3
jgi|Phyra1_1|87919|fgenesh1_pg.C_scaffold_2855000001 164328.JGI87919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]