SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI95097 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI95097
Domain Number 1 Region: 2109-2288
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-34
Family cAMP-binding domain 0.0006
Further Details:      
 
Domain Number 2 Region: 1388-1568
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-33
Family cAMP-binding domain 0.00094
Further Details:      
 
Domain Number 3 Region: 614-793,840-904
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.92e-21
Family Voltage-gated potassium channels 0.0044
Further Details:      
 
Domain Number 4 Region: 383-546
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-20
Family cAMP-binding domain 0.00097
Further Details:      
 
Domain Number 5 Region: 909-1075
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.11e-19
Family cAMP-binding domain 0.0054
Further Details:      
 
Domain Number 6 Region: 1138-1383
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.15e-18
Family Voltage-gated potassium channels 0.0061
Further Details:      
 
Domain Number 7 Region: 1990-2142
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000119
Family Voltage-gated potassium channels 0.0058
Further Details:      
 
Domain Number 8 Region: 173-265,318-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000262
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI95097
Sequence length 2336
Comment (Phytophthora ramorum)
Sequence
MTRLSAMRERAASTAPSGGEAWKQSEWGGPMGKIINFCRRRKRGLFVGMVVLELFYVFVS
VPLRIGFLFDPYSSKTWSTGWTTELTVLTVLDVLADAASFASLLDIFAAQRREQAALAAD
ATGAIGIRRQRTTQGPKPTERRSSLLSRMRDSMLVAWSLNTILPASHSHRGIQRPVLIEI
TSMVPLELLALGFGPNSLHLLRMLKLLRLYRVSGCARELKQMYTGSKIVQKLEYTGNAVL
FNTVALGLAACHWIACGYMAIAHLECGIDFMLCSKAHIVLRTIPGAGEHGTAEGITGVSP
TGDGSGYTCWAIEDYLVGTGVGRKYGRAAYWAARSVMTTGFYDVGATTNAETLYVIFAQI
VGAIFSTAVLATFLFIFRYRNARMQEFMAHVDNANEYMQMRHFPETVRDGVLGYYKNAWA
THHALRHDEAIERLPGHLRAHRIQNVAFLAKESVEFVNTLALRIEYCVYSPKDWVIEKLP
DGMYFVLRGSVKLDGPAHPMAHFAKTGDHFAEGCLLFPGRTDERARAQTFCDLYKLPQRA
FYKTLTIFYRENAPKHLEDMRSKHARRDQQEQKMKKMLGRSSDNVTGAANSHTSSTGRFS
VTFGSDHIPWRTPGSNFRKWWEHARLFSIVFVIFEVPLYCVFDADTFPFGEKSKYSLQSM
TSILVEGFFIADFVFRARFFAYIDQLALITVSDPSYIFDAYRESGLWRDLLAILPLPLVV
EFIVKRGSGWTMWLHMSRLVRLFRARYLQQTIVEFAHLRAISSKIQQAGTMLLYVSITLH
VAGCLWFLMARFSVLEEEFEPIVEEFTRDRCLRDAGLHGNCSWTLYDAYGQIGTTFKVQD
PASIYTVKMAYVRSIYWAIVALTTVGYGDVVAFSTYESYFAAVWCFVGGLINYGVVGAMS
NIISNLTASSRHHSEKMNTINVTLGHFRISESVRARIRQFYHQQLYVQKVTSEAQLLDGL
PMQLRHRISSILHAESVRKVPLFIDAQNERLLYELTGLFRRQLFQRGDPFFAEGTLCEEM
YVVVSGRANIFSKRLGTVPVGALSAGDCFGVFTAATVVDASVITYTAFVAKIERHFPAEM
ESLRMQATQQHIFDMLTLEAVIDNIKSRSTLSKFTEQCASMFEEKENWTQQRLKMRLRLY
WDLIVLVLDIYNAFLVTFRIGFLAHPSSGLRMGLVVSDFVGDTLLAADIYLKLYFFECEE
VGLNNLISREERSTTYTGHELRGDLLSSLPLYYVGSSFLAMSLCRLPRLLRLRQVPETID
SLIMRLQQRFATGGNISAYLSPIKLVLILLFTGHLAACVFYLICHTDHNPKSWTHHDPIV
HMEHESIGVLYLRAFYWALTTLTLVGSREIVPLGMAATIWATFTCLCCAFIVGHIVGELS
ELILDMDKTKKEFKERESHFDAFARDHDLPASIRTRVLHYLKFQHHYLKGLDIYDTFSDL
SPNLRVQLMMDLHGDTLQNLCIAPFLNQAQINGLAVRLKSELYIPGDTIIVEGDLGHKLY
IVKGGTGMVLWKSTGTAVATITAGSLFGEVAFFLRGQRRIASVQATTCSELLVLGRRAWE
ELLASSPREEAESTERALVQWVQYCLKGYNIMTVEIVKDIKSGGGDSGRSKQPKLIEELR
DLNANSQLYPVILYRWVLNNILPSGRKSAKLGRVYADTSPGTPSLPLIRSKSFKNGTSVQ
INPVSRSMREYYREDQLVEMEDECWRRYKVSLFMAEAFTVAVVEQTPPANYESRNRPSQR
GLREKRQPRGSIGRHQDRNGHGHHLHQSFGLAVLPSGAARAHRRQRKLKRSQSLPLFDRH
FALMIRDELQDSNAKESDSKLNLGFELLQRCRQSEFSSLFQVYLSWLKRTDRWNQWGKQQ
LMSTSTKAEDFVNFLSRCYRLWEWVIVCVGGFYAVTIPFFVYLALKHSAFRRVLYLSAGG
STDIPVAKRRAPTVAASLSSAGTSTLVDHRWFYMSLFQMNKVPRIVESIEASERLTQFLA
ADLNLPISESRLHFIRTVAVYVLSGHWIACLWFRLGLHAYEIYGASWLSTYKMLPVDGFG
TLSEVPTSRRYLRSLHFAIGSITTVFYGDVVSMNVIETVVEIAFIVVCILLFGVLVGAQG
ELIEANYKHKMLFEQNLMELYNFLQNNDVPRDVRQRLRLYYTNTWLKYHGHDDLEGVRGL
SSLLVEDIAQYTLRNFANRVSILKSCDESFLRSLLTCLKHIICSSAEAVVRKGDVDRSMY
FIAKGKVLVQGPGFELVKHEGDFFGELSLLYGIPRSATCSSLGVSLLYVLEWETYEKLLA
DYPEYREQNRREWVIVSTVLKTGESRFRSIIDIVARMEKVNWVLVDEIIRKAKSLK
Download sequence
Identical sequences H3HCE5
jgi|Phyra1_1|95097|C_scaffold_31000004 164328.JGI95097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]