SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI96614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI96614
Domain Number 1 Region: 200-233,262-327
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-20
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Weak hits

Sequence:  164328.JGI96614
Domain Number - Region: 398-488
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.00689
Family Potassium channel NAD-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI96614
Sequence length 999
Comment (Phytophthora ramorum)
Sequence
MGMICVNQNEESNRTTSTPRCVADWAHTQEQVVHATYLLAGLLLISLLWTVASRRQRKSL
RKGELGFSLNCRRWARTSRTAAIINRPVQLLVSFGILGLTMSRLNSYDVTEGSYYTVLGL
YVVAIVDDVVRFLASRYKLLFCFSPLTLLELLCLASNFGVGFGSVKMIGGVRTRTYLDFS
VMRPVFILRSYLEMEKHVPSSTKGWMMVRLGIKILLMIMVGASIMFFVETLGELPFFTDN
GFAHLYSCNDGSVTRHESSECSDATWSVMFAFYFTVVTLGTVGYGDNAPQTVPSRLLAIM
FIVMGIILFSMEIDNLISLYKLRQIGNPPYTPKPDSKHVLVIGNPSFAQLSAILRELFHA
DHLSDSDTQQLEAVVLGEVKSTFTKPLIAKLKADPIFTSRVTYVAGNATRADDLERCLAR
DARAIFVFPDKLTGDPATEDAMNIMRVLATKRYVGSSVRFLVMVLRAESARHMLAAGVHP
DDIISPLLAVVGKDKSMGPDILTAEVVDKELSEHSWIKEYYAGAAKEMYLIHLSKETSGT
VLLIGVEVMFSDEGLKFNEETESLFNYKVCPDEVRREDMLRPGSTSTIMNQAGDVYQPML
SPSHEDDLPCDELRSLTAYTAYMTPNYDSMKHRSPLTSSATGSLVLDRSLESIALSFKNS
NRNITSGNPYETAHFQESLQWLILPLRSPHATSHPPITILDTAEPSPILVRTLAAFKNVY
YVRGSPLVYSDLQRAGAKAAAAVVVLGKRAKNTAIAESASDAELESSIADAEAIFATMLV
ELKMDFAKIFTVTELADEANSKFMGMSFQLNQLQTAVGIGADVSGMGVLKLWNHVLQHDA
QEQKSEKEIFGLPLYMSGRILHPELCENMVVQTYFNPSIHKIVRQLVGGPRCTGVIHTFS
LPRALRSDCTYADVFHSFAASSYSGICIGIYRMSTQAMGSSNQADLEILSSDRLFVLIGV
HTLERAAMRIQKRYRLHKGIPDPLKRDEGAKRGKHALYV
Download sequence
Identical sequences H3HE03
jgi|Phyra1_1|96614|C_scaffold_88000013 164328.JGI96614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]