SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI96900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI96900
Domain Number - Region: 523-544
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00192
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI96900
Sequence length 654
Comment (Phytophthora ramorum)
Sequence
METSPLLEKQWSQSKQPPAWHDFVDLSAMAAQVSMATLARAALLAIDSVFLGHLGVKELA
AASLAQLWTSPALYSVWASASALNTLCGQSWGAGNRELTGIWLQFGLMITTLLSVPVTIW
YWCVGYVLEYSTSDQEVIALATTFSRVLSGSILPSLLYCCLRQYLQAMGVLVPTTIVGMV
SIFVAVGSNYVLIYGVGSWHGLGFVGSPIATVVASWFQPIALFSYAILYKKHHHRAWYGW
NTHALTLGRLRAFLRVAGPISSNSFVSNLANALVALVAARLGARVIAANAVISGLWTLLW
ALFWGYGCATQVRVANYLGAGKPDLARRITGLGFICTIVVVVLIATVASVMDQHIIALYT
TDKELLTTCKLVLPVFLAACVFEAVEILGAGALTGMSQVHTVFWTSAIATWLINLPVAYI
GGITMGYGFPALWVGVLSMELLKVGSYSLTLSHVRWGDMAERVKEAAESAPDMEQSRAHM
GDANGDAPLGKWAQRQEARRNMYATSTEQVRVHRRGLGASSASSAAAMCQKCLRPGHWTY
ECKNEAVYVQRPSRSQQLKNPKLRQPFNKDKPPELQDEEKAAEKSKKLKRKDKDNKAKKK
SSSSHTRHSDSDSSSDSSSSSSDSSGSDSDSSSSSSDSDRSGRRRHHSKRQRKN
Download sequence
Identical sequences H3HE91
jgi|Phyra1_1|96900|C_scaffold_118000012 164328.JGI96900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]