SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_A1749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164546.RALTA_A1749
Domain Number 1 Region: 118-366
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-67
Family D-glucarate dehydratase-like 0.0000733
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.61e-32
Family Enolase N-terminal domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_A1749
Sequence length 367
Comment (Cupriavidus taiwanensis)
Sequence
MKIASIEAIVLRIPFTVGGVSAAGVWGGAGMQAADSLLLKVSTDDGLVGWGETFGFVGIP
AVKAAIEQMLAPACIGRDASQIEAIGLDLQRRFHVFGRSGPLFYGLSALDIALWDLCGKA
AGLPVHRLLGGARREQLPAYASLIRYADADTIAVNVRRAIADGYRSLKLHEVDLAVIRAA
RAAAGPDIEITLDTNCPWTLPEAIDMARALQPLSLRWLEEPLWPPENYAGLAALRRRCAI
PLAAGENATTLMEFEHLLGMGAVDVVQPSPAKMGGISALRDVFALARAHNTQVMVHTFYD
GPGLLAAMHATAALGDTAAMIEWRYFDMAAQVLGDAVVPRDGMIALPAGPGLGIDPDPEV
IRRYRVG
Download sequence
Identical sequences B3R2H4
WP_012353012.1.21467 164546.RALTA_A1749 gi|194289850|ref|YP_002005757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]