SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_A2259 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164546.RALTA_A2259
Domain Number 1 Region: 39-221
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.91e-25
Family Clp protease, ClpP subunit 0.035
Further Details:      
 
Domain Number 2 Region: 395-457
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000183
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_A2259
Sequence length 479
Comment (Cupriavidus taiwanensis)
Sequence
MLRAFRLLSSLALACCALAFGGSGIAAPPAGTAMATAPVYVIPLKGAVSPASASFIVRGM
ARAREAGAQLVVLEMDTPGGLDASMRDIIQAILASPVPVASYVSPGGARAASAGTYILYA
SHLAAMAPGTNLGAATPVQVGIGGPQKPDALPGASPASAPASAPPAGDTMARKQMHDASA
YIRGLAQLRGRNAEWAERAVRESVSLSADEALAQRVIDMVAADLPALLRQLDGRKLTTAG
GKASTLQTRNAPSVTLEPDWRNRFLAVITEPSVALLLMMIGIYALIFEFSTPGMVVPGIV
GAICLLLALFALHMLPVNYAGLALVALGIGCMVAELFLPTFGALGVGGIIAFAFGAVMLI
DTDVPGFGVPLPMVAAMSALSAVFVFGMSAMLVRSRKRPVVSGADTLVGSRGELLDDLRE
EGWATVRGETWRVRSATPLARGTPVLVTARHGLVLEVVAAGGAALAPSPSSQPKPDKGA
Download sequence
Identical sequences B3R5G8
164546.RALTA_A2259 gi|194290349|ref|YP_002006256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]