SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164546.RALTA_A2402 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164546.RALTA_A2402
Domain Number 1 Region: 20-234
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-79
Family Phosphate binding protein-like 0.000000541
Further Details:      
 
Domain Number 2 Region: 235-324
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 1.06e-23
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164546.RALTA_A2402
Sequence length 336
Comment (Cupriavidus taiwanensis)
Sequence
MSSATPSSATAVVSRNLPQKLVIASRESRLALWQAEHVRAALQQYYPACDVSILGMTTRG
DQILDRTLSKVGGKGLFVKELEFAMDEGRADLAVHSLKDVPMELPPGFTLAAVMEREDPR
DALVSSAYASLDEMPPGTVVGTSSLRREAALRSRYPHLVVKPLRGNLDTRLGKLDRGEYG
AIILAAAGLKRLGLGDRIRALIPLEASLPAAGQGALGIETLSTRPELAEWLAPLNHQPTA
LAVTAERAVSRRLGGSCQVPLAAHARWDGDQLRLEAFVALPDGSRAIRAAAAGPAADLAA
AEALGQACAGDLLAQGAESILAALADSGDAASPSPA
Download sequence
Identical sequences B3R611
gi|194290490|ref|YP_002006397.1| 164546.RALTA_A2402 WP_012353636.1.21467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]