SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_0186 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_0186
Domain Number 1 Region: 59-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000034
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_0186
Sequence length 311
Comment (Mycobacterium MCS)
Sequence
MGFDGRDSDADTGPAVEETPYMEWTATVAGIALIAVIVRDVFHTLFHPIGHGSIAPTVMK
LIWRLLGLLPPQRRIASLTGPLGIAMVVLAWGVIAVAGWTLIYWAQMPEGFAYGTELDPN
ERHDIVDSLYLSLVTIGTLGFGDVVPTSVTLRLAAPIEALFGFMLLTAAVSWVLEIYPAL
HRRRVLALQLSTLRRAREGDPVLPIDSVPVEVLTSLAAGIVEARNDFTQYSATYYFRDLE
TDASLAASLEYATQLAAEAMASAQDHVRTAGRLMKIAVDSLAELLDQEFLQLGGDTDAVV
QAYAVDHRHIN
Download sequence
Identical sequences A1U9A5
WP_011557613.1.20321 WP_011557613.1.47369 164756.Mmcs_0186 189918.Mkms_0195 gi|108797166|ref|YP_637363.1| gi|119866251|ref|YP_936203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]