SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_2599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164756.Mmcs_2599
Domain Number - Region: 36-77
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000666
Family GalR/LacI-like bacterial regulator 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_2599
Sequence length 121
Comment (Mycobacterium MCS)
Sequence
MAEQRRIGFHWHLRRVMAAHNLWKSTELRPLLRSRGINLSDAQVYRLVTGEPQRIPSRTF
AALCDIFDCTPNDLFEPYVEMQAAASANAPQPRELGVTPGNPVAKRIRIVQDDVDGTTPE
A
Download sequence
Identical sequences A1UG80
gi|119868676|ref|YP_938628.1| gi|108799566|ref|YP_639763.1| 164756.Mmcs_2599 189918.Mkms_2643 WP_011559993.1.20321 WP_011559993.1.37251 WP_011559993.1.47369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]