SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_3127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_3127
Domain Number 1 Region: 83-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000051
Family NfeD domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_3127
Sequence length 144
Comment (Mycobacterium MCS)
Sequence
MPVWLIWLVLAIVLAGAEALTGDMFLLMLSGGALAATGTSWLFDWPIWADGVVFLLVSVL
LLGVVRPVLRRRFYAGTGLPEPAKALEGKTALVLDRVAQHAGQVKLEGEVWTARPLDDND
VYEPGDQVTVMRIDGATAVVWKNP
Download sequence
Identical sequences A0A1A0U607 A0A1X0H0Y7 A1UHS4
WP_011560520.1.20321 WP_011560520.1.3374 WP_011560520.1.44017 WP_011560520.1.47369 WP_011560520.1.73225 gi|108800093|ref|YP_640290.1| gi|126435717|ref|YP_001071408.1| gi|119869220|ref|YP_939172.1| 164756.Mmcs_3127 164757.Mjls_3138 189918.Mkms_3188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]