SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_4240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_4240
Domain Number 1 Region: 137-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.24e-124
Family Enolase 0.0000000432
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.83e-52
Family Enolase N-terminal domain-like 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_4240
Sequence length 429
Comment (Mycobacterium MCS)
Sequence
MPIIEQVGAREILDSRGNPTVEVELALTDGTFARAAVPSGASTGEHEAVELRDGGSRYGG
KGVDKAVQAVLDDIAPAVIGMSADDQRLIDQALLDLDGTPDKSRLGANAILGVSLAVSKA
AAESAGLPLFRYLGGPNAHILPVPMMNILNGGAHADTGVDVQEFMVAPIGAPSFKEALRW
GAEVYHSLKSVLKKQGLSTGLGDEGGFAPDVAGTKAALDLISSAIEAAGFKLGTDVTLAL
DVAATEFYTEGTGYSFEKETRTAEQMAEFYASLLDAYPLVSIEDPLSEDDWDGWVSLTTQ
IGDRVQLVGDDLFVTNPERLEEGIERGAANALLVKVNQIGTLTETLDAVALAHNSGYRTM
MSHRSGETEDTTIADLAVAVGSGQIKTGAPARSERVAKYNQLLRIEETLGDAARYAGDLA
FPRFALETK
Download sequence
Identical sequences A0A1X0GN59 A1UL09 A3Q5F7 Q1B439
gi|108801204|ref|YP_641401.1| WP_011561618.1.20321 WP_011561618.1.3374 WP_011561618.1.37251 WP_011561618.1.44017 WP_011561618.1.47369 gi|126437184|ref|YP_001072875.1| gi|119870355|ref|YP_940307.1| 164756.Mmcs_4240 164757.Mjls_4619 189918.Mkms_4326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]