SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_5185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_5185
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_5185
Sequence length 120
Comment (Mycobacterium MCS)
Sequence
MRGDAVVVRVKGDVDSLSVDALNSHLAKARGNAVCHPSRLVVIDLSEVTYFGSAALNAVL
SCHEEGAAEGTSVAIVADQPYVMQPIQITGLHRVLETHPTIEQALQRDGQSPDGEGRTPR
Download sequence
Identical sequences A1UNQ5
164756.Mmcs_5185 189918.Mkms_5274 gi|108802148|ref|YP_642345.1| gi|119871301|ref|YP_941253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]