SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164756.Mmcs_5425 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164756.Mmcs_5425
Domain Number 1 Region: 242-441
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 2 Region: 22-148
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000137
Family PFOR PP module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164756.Mmcs_5425
Sequence length 563
Comment (Mycobacterium MCS)
Sequence
MGAEGSQWIGQAPFTDVPHLFQNIGDGTFFHSGQLAVQACVAAGVNITYKLLWNEVVAMT
GAQHAEGAVTVAQLTRKLTAEGVRQIIICADEPERHHRRALAKGTLVWHRDRLDEAQKRL
RDIEGVTVLIYDQHCAADARRQRKRGTLPARTTRVLINEAVCEGCGDCGVKSNCLSVQPV
DTEYGRKTRIDQTSCNTDYSCLDGDCPSFVTVEVRPDAMRRHRTTPTPPALPDVDTGAVT
DTHNVFFAGIGGTGIVTVNQVLATAALRAGYDVESLDQIGLSQKAGPVVSHLRFAAGKLD
PANRLTPGSADCIIAFDLLVAADSKNLGYGDLAKTISVASTSKTSTGDMVYDKTIAYPET
PYLLHRLDQVSHRVHGFDALEAARTLFGDTATANFLLVGAACQTGALGIPAAAIEEAIEI
NGVAVETNVAAFRWGRAAIADPIRFHDVVSPVPDRHPTPLPARVLDGATFSGHVGDLITR
RAADLVAFQSEKVARRFRLLGDRSLQDHAWRIAAKLNWPDTYQAEYIALTQLQADALATA
DPQLAAAARTFVPAVTPADILRP
Download sequence
Identical sequences A1UQS3
gi|108802385|ref|YP_642581.1| 164756.Mmcs_5425 189918.Mkms_6009 WP_011562988.1.20321 WP_011562988.1.47369 gi|108802385|ref|YP_642581.1|NC_008147 gi|119855393|ref|YP_935996.1|NC_008704 gi|119855393|ref|YP_935996.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]